- Recombinant Bacillus subtilis UPF0410 protein ydaS (ydaS)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1065733
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 8,649 Da
- E Coli or Yeast
- 31048
- UPF0410 protein ydaS (ydaS)
Sequence
MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGHGLLGTWGPSLAGFAIFPAIIGAAIFVFLLGLIFRGLRKEA